Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: P05198
RecName: Eukaryotic translation initiation factor 2 subunit 1
Begin-End: 14-88
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVV
IRVDKEKGYIDLSKR
Structures of the domain P05198 14-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ybv X-ray 3.8 r 14-88 None


© NPIDB team 2003 - 2021

text