Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: P05317
RecName: 60S acidic ribosomal protein P0
Begin-End: 3-105
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVLMGKNTMVRRA
IRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVSNRV
Structures of the domain P05317 3-105
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j16 X-ray 7.2 G 5-103 None


© NPIDB team 2003 - 2019

text