Pfam domain
Pfam family: Bac_DNA_binding (PF00216.20)
Uniprot AC: P05514
RecName: DNA-binding protein HU
Begin-End: 1-90
Organism: Nostoc sp.
Interaction Mode:   

Sequence:
MNKGELVDAVAEKASVTKKQADAVLTAALETIIEAVSSGDKVTLVGFGSFESRERKAREG
RNPKTNEKMEIPATRVPAFSAGKLFREKVA
Structures of the domain P05514 1-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1p51 X-ray 2.5 B 1-89 None
1p51 X-ray 2.5 A 1-89 None
1p51 X-ray 2.5 D 1-89 None
1p51 X-ray 2.5 C 1-89 None
1p71 X-ray 1.9 B 1-89 None
1p71 X-ray 1.9 A 1-89 None
1p78 X-ray 2.25 B 1-89 None
1p78 X-ray 2.25 A 1-89 None


© NPIDB team 2003 - 2019

text