Pfam domain
Pfam family: H2TH (PF06831.13)
Uniprot AC: P05523
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 129-217
Organism: Escherichia coli
Interaction Mode:   

Sequence:
LGPEPLSDDFNGEYLHQKCAKKKTAIKPWLMDNKLVVGVGNIYASESLFAAGIHPDRLAS
SLSLAECELLARVIKAVLLRSIEQGGTTL
Structures of the domain P05523 129-217
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1k82 X-ray 2.1 D 128-216 None
1k82 X-ray 2.1 A 128-216 None
1k82 X-ray 2.1 C 128-216 None
1k82 X-ray 2.1 B 128-216 None


© NPIDB team 2003 - 2019

text