Pfam domain
Pfam family: Fapy_DNA_glyco (PF01149.23)
Uniprot AC: P05523
RecName: Formamidopyrimidine-DNA glycosylase
Begin-End: 2-114
Organism: Escherichia coli
Interaction Mode:   

Sequence:
PELPEVETSRRGIEPHLVGATILHAVVRNGRLRWPVSEEIYRLSDQPVLSVQRRAKYLLL
ELPEGWIIIHLGMSGSLRILPEELPPEKHDHVDLVMSNGKVLRYTDPRRFGAW
Structures of the domain P05523 2-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1k82 X-ray 2.1 D 1-113 None
1k82 X-ray 2.1 A 1-113 None
1k82 X-ray 2.1 C 1-113 None
1k82 X-ray 2.1 B 1-113 None


© NPIDB team 2003 - 2019

text