Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: P05647
RecName: 50S ribosomal protein L34
Begin-End: 1-44
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
MKRTFQPNNRKRSKVHGFRSRMSSKNGRLVLARRRRKGRKVLSA
Structures of the domain P05647 1-44
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j3v X-ray 13.3 2 1-44 None
3j3w X-ray 10.7 2 1-44 None


© NPIDB team 2003 - 2019

text