Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: P05725
RecName: DNA endonuclease I-CreI
Begin-End: 13-108
Organism: Chlamydomonas reinhardtii
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQRRWFLDKLVDEIGVGYVRDRGS
VSDYILSEIKPLHNFLTQLQPFLKLKQKQANLVLKI
Structures of the domain P05725 13-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1g9y X-ray 2.05 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1g9y X-ray 2.05 B 213-289  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aaf X-ray 2.5 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aaf X-ray 2.5 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3p X-ray 2.3 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3p X-ray 2.3 B 313-389  H-Bb S-Bb S-Mj L-Bb L-Mj 
1g9z X-ray 1.8 A 13-89 None
1g9z X-ray 1.8 B 213-289  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbj X-ray 1.95 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbj X-ray 1.95 A 13-91  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 D 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 C 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3q X-ray 2.3 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3q X-ray 2.3 B 313-389  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbl X-ray 1.8 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbl X-ray 1.8 A 13-91  H-Bb S-Bb S-Mj L-Bb L-Mj 
1u0d X-ray 2.9 B 313-389 None
1u0d X-ray 2.9 A 13-89 None
1n3f X-ray 2 G 513-589  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3f X-ray 2 H 713-789  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3f X-ray 2 B 213-289  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3f X-ray 2 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 D 610-686  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 A 110-186  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 G 1110-1173  S-Bb S-Mj L-Bb L-Mj 
1n3e X-ray 2.5 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3e X-ray 2.5 B 213-289  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3e X-ray 2.5 H 713-789 None
1n3e X-ray 2.5 G 513-589 None
4aqu X-ray 2.3 B 213-289  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aqu X-ray 2.3 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aad X-ray 3.1 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aad X-ray 3.1 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aae X-ray 2.6 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aae X-ray 2.6 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbo X-ray 1.8 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbo X-ray 1.8 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aqx X-ray 2.2 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aqx X-ray 2.2 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbn X-ray 1.9 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbn X-ray 1.9 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aab X-ray 2.5 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aab X-ray 2.5 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1u0c X-ray 2.5 B 313-389  H-Bb S-Bb S-Mj L-Bb L-Mj 
1u0c X-ray 2.5 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aag X-ray 2.8 B 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aag X-ray 2.8 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9i X-ray 1.6 B 313-389  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9i X-ray 1.6 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9j X-ray 2 B 313-389  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9j X-ray 2 A 13-89  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text