Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.21)
Uniprot AC: P05725
RecName: DNA endonuclease I-CreI
Begin-End: 13-108
Organism: Chlamydomonas reinhardtii
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LAGFVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTQRRWFLDKLVDEIGVGYVRDRGS
VSDYILSEIKPLHNFLTQLQPFLKLKQKQANLVLKI
Structures of the domain P05725 13-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1g9y X-ray 2.05 B 213-304  H-Bb S-Bb S-Mj L-Bb L-Mj 
1g9y X-ray 2.05 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3p X-ray 2.3 B 313-405  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3p X-ray 2.3 A 13-105  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbj X-ray 1.95 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbj X-ray 1.95 A 13-109  H-Bb S-Bb S-Mj L-Bb L-Mj 
1g9z X-ray 1.8 B 213-304  H-Bb S-Bb S-Mj L-Bb L-Mj 
1g9z X-ray 1.8 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 D 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1bp7 X-ray 3 C 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3q X-ray 2.3 B 313-404  H-Bb S-Bb S-Mj L-Bb L-Mj 
2i3q X-ray 2.3 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbl X-ray 1.8 A 13-109  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbl X-ray 1.8 B 13-128  H-Bb S-Bb S-Mj L-Bb L-Mj 
1u0d X-ray 2.9 B 313-404  H-Bb S-Bb S-Mj L-Bb L-Mj 
1u0d X-ray 2.9 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3f X-ray 2 G 513-603  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3f X-ray 2 H 713-803  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3f X-ray 2 B 213-303  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3f X-ray 2 A 13-103  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 A 110-203  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 D 610-703  H-Bb S-Bb S-Mj L-Bb L-Mj 
1mow X-ray 2.4 G 1110-1206  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3e X-ray 2.5 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3e X-ray 2.5 B 213-304  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3e X-ray 2.5 H 713-804  H-Bb S-Bb S-Mj L-Bb L-Mj 
1n3e X-ray 2.5 G 513-604  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aaf X-ray 2.5 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aaf X-ray 2.5 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aag X-ray 2.8 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aag X-ray 2.8 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aab X-ray 2.5 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aab X-ray 2.5 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aad X-ray 3.1 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aad X-ray 3.1 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aae X-ray 2.6 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aae X-ray 2.6 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbo X-ray 1.8 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbo X-ray 1.8 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aqx X-ray 2.2 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aqx X-ray 2.2 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbn X-ray 1.9 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
2vbn X-ray 1.9 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1u0c X-ray 2.5 B 313-412  H-Bb S-Bb S-Mj L-Bb L-Mj 
1u0c X-ray 2.5 A 13-112  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aqu X-ray 2.3 B 213-304  H-Bb S-Bb S-Mj L-Bb L-Mj 
4aqu X-ray 2.3 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb2 X-ray 2.95 B 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb2 X-ray 2.95 A 13-117  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb1 X-ray 3.02 B 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb1 X-ray 3.02 A 13-117  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb5 X-ray 2.2 B 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb5 X-ray 2.2 A 13-117  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb6 X-ray 2.6 B 13-107  S-Bb S-Mj L-Bb L-Mj 
6fb6 X-ray 2.6 A 13-117  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb7 X-ray 2.69 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb7 X-ray 2.69 B 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb8 X-ray 2.45 B 213-304  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb8 X-ray 2.45 A 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb9 X-ray 2.95 A 13-107  H-Bb S-Bb S-Mj L-Bb L-Mj 
6fb9 X-ray 2.95 B 213-304  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9i X-ray 1.6 B 313-408  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9i X-ray 1.6 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9j X-ray 2 A 13-104  H-Bb S-Bb S-Mj L-Bb L-Mj 
1t9j X-ray 2 B 313-404  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text