Pfam domain
Pfam family: Ribosomal_L6 (PF00347.22)
Uniprot AC: P05738
RecName: 60S ribosomal protein L9-A
Begin-End: 12-85
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VPEGVTVSIKSRIVKVVGPRGTLTKNLKHIDVTFTKVNNQLIKVAVHNGGRKHVAALRTV
KSLVDNMITGVTKG
Structures of the domain P05738 12-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3j16 X-ray 7.2 F 12-85 None
6em5 X-ray 4.3 H 12-85 None


© NPIDB team 2003 - 2019

text