Pfam domain
Pfam family: Ribosomal_L22 (PF00237.18)
Uniprot AC: P05740
RecName: 60S ribosomal protein L17-A
Begin-End: 17-151
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIPFRRFNSSIGRTAQGKEF
GVTKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVNQAPKQRRRTYRAHGRI
NKYESSPSHIELVVT
Structures of the domain P05740 17-151
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wwb X-ray 6.48 I 17-151 None
2wwa X-ray 8.9 I 17-151 None
2ww9 X-ray 8.6 I 17-151 None
6em4 X-ray 4.1 P 17-124 None
6em3 X-ray 3.2 P 17-124 None
6em5 X-ray 4.3 P 17-124 None


© NPIDB team 2003 - 2019

text