Pfam domain
Pfam family: KOW (PF00467.28)
Uniprot AC: P05743
RecName: 60S ribosomal protein L26-A
Begin-End: 52-90
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKV
Structures of the domain P05743 52-90
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wwb X-ray 6.48 L 53-83 None
2wwa X-ray 8.9 L 53-83 None
2ww9 X-ray 8.6 L 53-83 None
6em4 X-ray 4.1 Y 53-83 None
6em3 X-ray 3.2 Y 53-83 None
6em5 X-ray 4.3 Y 52-82 None


© NPIDB team 2003 - 2019

text