Pfam domain
Pfam family: Ribosomal_L26 (PF16906.4)
Uniprot AC: P05743
RecName: 60S ribosomal protein L26-A
Begin-End: 9-122
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVRGSKKGQEG
KISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVITKLHLDKDRKALIQRK
Structures of the domain P05743 9-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2wwb X-ray 6.48 L 9-122 None
2wwa X-ray 8.9 L 9-122 None
2ww9 X-ray 8.6 L 9-122 None
6em4 X-ray 4.1 Y 9-122 None
6em3 X-ray 3.2 Y 9-122 None
6em5 X-ray 4.3 Y 8-121 None


© NPIDB team 2003 - 2019

text