Pfam domain
Pfam family: Ribosomal_L35Ae (PF01247.17)
Uniprot AC: P05744
RecName: 60S ribosomal protein L33-A
Begin-End: 7-101
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LYVKGKHLSYQRSKRVNNPNVSLIKIEGVATPQDAQFYLGKRIAYVYRASKEVRGSKIRV
MWGKVTRTHGNSGVVRATFRNNLPAKTFGASVRIF
Structures of the domain P05744 7-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 f 9-103 None
6em3 X-ray 3.2 f 9-103 None
6em5 X-ray 4.3 f 7-101 None


© NPIDB team 2003 - 2019

text