Pfam domain
Pfam family: Ribosomal_L15e (PF00827.16)
Uniprot AC: P05748
RecName: 60S ribosomal protein L15-A
Begin-End: 2-190
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRLGYKAKQGFVI
YRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRAANLRVLNSYWV
NQDSTYKYFEVILVDPQHKAIRRDARYNWICDPVHKHREARGLTATGKKSRGINKGHKFN
NTKAGRRKT
Structures of the domain P05748 2-190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em4 X-ray 4.1 N 96-187 None
6em3 X-ray 3.2 N 100-191 None


© NPIDB team 2003 - 2019

text