Pfam domain
Pfam family: Ribosomal_L22e (PF01776.16)
Uniprot AC: P05749
RecName: 60S ribosomal protein L22-A
Begin-End: 11-108
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDGTVVTVVSTAK
FSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFY
Structures of the domain P05749 11-108
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6em5 X-ray 4.3 U 13-108 None


© NPIDB team 2003 - 2019

text