Pfam domain
Pfam family: Ribosomal_S3_C (PF00189.19)
Uniprot AC: P05750
RecName: 40S ribosomal protein S3
Begin-End: 105-188
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
MKFKLLNGLAIRRAAYGVVRYVMESGAKGCEVVVSGKLRAARAKAMKFADGFLIHSGQPV
NDFIDTATRHVLMRQGVLGIKVKI
Structures of the domain P05750 105-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 D 107-188 None


© NPIDB team 2003 - 2019

text