Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: P05750
RecName: 40S ribosomal protein S3
Begin-End: 20-96
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
ELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKY
APGTIVLYAERVQDRGL
Structures of the domain P05750 20-96
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 D 20-93 None


© NPIDB team 2003 - 2019

text