Pfam domain
Pfam family: Ribosomal_S13_N (PF08069.11)
Uniprot AC: P05756
RecName: 40S ribosomal protein S13
Begin-End: 2-60
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GRMHSAGKGISSSAIPYSRNAPAWFKLSSESVIEQIVKYARKGLTPSQIGVLLRDAHGV
Structures of the domain P05756 2-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 N 2-60 None
6eml X-ray 3.6 Y 2-60 None


© NPIDB team 2003 - 2019

text