Pfam domain
Pfam family: Ribosomal_S15 (PF00312.21)
Uniprot AC: P05756
RecName: 40S ribosomal protein S13
Begin-End: 70-148
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
KIMRILKSNGLAPEIPEDLYYLIKKAVSVRKHLERNRKDKDAKFRLILIESRIHRLARYY
RTVAVLPPNWKYESATASA
Structures of the domain P05756 70-148
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 N 74-146 None
6eml X-ray 3.6 Y 74-146 None


© NPIDB team 2003 - 2019

text