Pfam domain
Pfam family: Ribosomal_S27 (PF01599.18)
Uniprot AC: P05759
RecName: Ubiquitin-40S ribosomal protein S31
Begin-End: 102-147
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
VLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKCHSV
Structures of the domain P05759 102-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rbe X-ray 3.8 f 102-146 None
6eml X-ray 3.6 N 102-146 None


© NPIDB team 2003 - 2020

text