Pfam domain
Pfam family: Sigma54_CBD (PF04963.12)
Uniprot AC: P06223
RecName: RNA polymerase sigma-54 factor
Begin-End: 118-257
Organism: Klebsiella oxytoca
Interaction Mode:   

Sequence:
QSLQDYLMWQVELTPFTDTDRAIATSIVDAVDDTGYLTISVEDIVESIGDDEIGLEEVEA
VLKRIQRFDPVGVAAKDLRDCLLVQLSQFAKETPWIEEARLIISDHLDLLANHDFRSLMR
VTRLKEEVLKEAVNLIQSLD
Structures of the domain P06223 118-257
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nsr X-ray 3.8 M 48-257 None
5nss X-ray 5.8 M 48-257 None


© NPIDB team 2003 - 2019

text