Pfam domain
Pfam family: Sigma54_DBD (PF04552.12)
Uniprot AC: P06223
RecName: RNA polymerase sigma-54 factor
Begin-End: 316-473
Organism: Klebsiella oxytoca
Interaction Mode:   

Sequence:
GQFIRSNLQEARWLIKSLESRNDTLLRVSRCIVEQQQAFFEQGEEFMKPMVLADIAQAVE
MHESTISRVTTQKYLHSPRGIFELKYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAK
PLSDSKLTTMLSDQGIMVARRTVAKYRESLSIPPSNQR
Structures of the domain P06223 316-473
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5nsr X-ray 3.8 M 317-473 None
5nss X-ray 5.8 M 311-475 None


© NPIDB team 2003 - 2019

text