Pfam domain
Pfam family: Sigma70_r3 (PF04539.18)
Uniprot AC: P06224
RecName: RNA polymerase sigma factor SigA
Begin-End: 217-294
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
ETINKLIRVQRQLLQDLGREPTPEEIAEDMDLTPEKVREILKIAQEPVSLETPIGEEDDS
HLGDFIEDQEATSPSDHA
Structures of the domain P06224 217-294
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ckq X-ray 4.4 F 217-294  H-Bb 


© NPIDB team 2003 - 2021

text