Pfam domain
Pfam family: 5_3_exonuc (PF01367.19)
Uniprot AC: P06229
RecName: T5 flap endonuclease
Begin-End: 188-275
Organism: Escherichia phage T5
Interaction Mode:   

Sequence:
DVEQFISLKAIMGDLGDNIRGVEGIGAKRGYNIIREFGNVLDIIDQLPLPGKQKYIQNLN
ASEELLFRNLILVDLPTYCVDAIAAVGQ
Structures of the domain P06229 188-275
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hnk X-ray 2.22 B 190-263 None
5hnk X-ray 2.22 A 190-263 None


© NPIDB team 2003 - 2019

text