Pfam domain
Pfam family: Ribosomal_S11 (PF00411.18)
Uniprot AC: P06367
RecName: 40S ribosomal protein S14-A
Begin-End: 15-129
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
GVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPYAAMLAAQDVAAKCKEV
GITAVHVKIRATGGTRTKTPGPGGQAALRALARSGLRIGRIEDVTPVPSDSTRKK
Structures of the domain P06367 15-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fai X-ray 3.4 O 15-133 None
6eml X-ray 3.6 Z 15-133 None


© NPIDB team 2003 - 2019

text