Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P06401
RecName: Progesterone receptor
Begin-End: 565-634
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
KICLICGDEASGCHYGVLTCGSCKVFFKRAMEGQHNYLCAGRNDCIVDKIRRKNCPACRL
RKCCQAGMVL
Structures of the domain P06401 565-634
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2c7a X-ray 2.5 B 566-633  H-Bb H-Mj S-Bb L-Bb 
2c7a X-ray 2.5 A 566-633  H-Bb H-Mj S-Bb L-Bb 
5cc0 X-ray 2.41 B 420-487  H-Bb H-Mj S-Bb L-Bb 
5cc0 X-ray 2.41 A 420-487  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text