Pfam domain
Pfam family: Ribosomal_L2 (PF00181.22)
Uniprot AC: P06509
RecName: 50S ribosomal protein L2, chloroplastic
Begin-End: 38-114
Organism: Spinacia oleracea
Interaction Mode:   

Sequence:
GRNARGIITARHRGGGHKRLYRKIDFRRNEKDIYGKIVTIEYDPNRNAYICLIHYGDGEK
RYILHPRGAIIGDTIVS
Structures of the domain P06509 38-114
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x8t X-ray 3.3 C 38-114 None
5h1s X-ray 3.5 E 104-114 None
5mlc X-ray 3.9 D 38-114 None
5mmi X-ray 3.25 C 38-114 None


© NPIDB team 2003 - 2019

text