Pfam domain
Pfam family: HTH_3 (PF01381.21)
Uniprot AC: P06533
RecName: HTH-type transcriptional regulator SinR
Begin-End: 6-61
Organism: Bacillus subtilis
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj 

Sequence:
IKQYRKEKGYSLSELAEKAGVAKSYLSSIERNLQTNPSIQFLEKVSAVLDVSVHTL
Structures of the domain P06533 6-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3zkc X-ray 3 B 6-58  H-Bb H-Mj S-Bb L-Bb L-Mj 
3zkc X-ray 3 A 6-58  H-Bb L-Bb 


© NPIDB team 2003 - 2020

text