Pfam domain
Pfam family: zf-C4 (PF00105.17)
Uniprot AC: P06536
RecName: Glucocorticoid receptor
Begin-End: 438-507
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj S-Bb S-Mj L-Bb 

Sequence:
KLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRY
RKCLQAGMNL
Structures of the domain P06536 438-507
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1glu X-ray 2.9 B 439-506 None
1glu X-ray 2.9 A 439-506 None
3g9o X-ray 1.65 A 439-506  H-Bb H-Mj L-Bb 
3g9o X-ray 1.65 B 439-506  H-Bb H-Mj L-Bb 
3g8u X-ray 1.9 A 439-506  H-Bb H-Mj L-Bb 
3g8u X-ray 1.9 B 439-506  H-Bb H-Mj S-Bb L-Bb 
3g9j X-ray 2.32 A 439-506  H-Bb H-Mj S-Bb L-Bb 
3g9j X-ray 2.32 B 439-506  H-Bb H-Mj S-Bb L-Bb 
3g9m X-ray 1.61 B 439-506  H-Bb H-Mj S-Mj L-Bb 
3g9m X-ray 1.61 A 439-506  H-Bb H-Mj L-Bb 
1r4r X-ray 3 B 439-506  H-Bb H-Mj L-Bb 
1r4r X-ray 3 A 439-506  H-Bb H-Mj S-Bb L-Bb 
3g8x X-ray 2.05 B 439-506  H-Bb H-Mj S-Mj L-Bb 
3g8x X-ray 2.05 A 439-506  H-Bb H-Mj L-Bb 
3g6u X-ray 1.9 A 439-506  H-Bb H-Mj L-Bb 
3g6u X-ray 1.9 B 439-506  H-Bb H-Mj L-Bb 
1lat X-ray 1.9 B 439-506  H-Bb H-Mj S-Bb L-Bb 
1lat X-ray 1.9 A 439-506  H-Bb H-Mj S-Bb L-Bb 
1r4o X-ray 2.5 B 439-506  H-Bb H-Mj S-Bb L-Bb 
1r4o X-ray 2.5 A 439-506  H-Bb H-Mj S-Bb L-Bb 
3g9i X-ray 1.85 A 439-506  H-Bb H-Mj L-Bb 
3g9i X-ray 1.85 B 439-506  H-Bb H-Mj L-Bb 
3g9i X-ray 1.85 B 439-506  H-Bb H-Mj L-Bb 
3g9i X-ray 1.85 A 439-506  H-Bb H-Mj L-Bb 
3g6t X-ray 1.9 B 439-507  H-Bb H-Mj L-Bb 
3g6t X-ray 1.9 A 439-507  H-Bb H-Mj L-Bb 
3g9p X-ray 1.65 B 439-506  H-Bb H-Mj L-Bb 
3g9p X-ray 1.65 A 439-506  H-Bb H-Mj L-Bb 
3g6p X-ray 1.99 B 439-506  H-Bb H-Mj S-Bb L-Bb 
3g6p X-ray 1.99 A 439-506  H-Bb H-Mj S-Bb L-Bb 
3g6q X-ray 2.26 A 439-506  H-Bb H-Mj L-Bb 
3g6q X-ray 2.26 B 439-506  H-Bb H-Mj L-Bb 
3g6q X-ray 2.26 B 439-506  H-Bb H-Mj L-Bb 
3g6q X-ray 2.26 A 439-506  H-Bb H-Mj L-Bb 
3g6r X-ray 2.3 A 439-506  H-Bb H-Mj S-Bb S-Mj L-Bb 
3g6r X-ray 2.3 B 439-506  H-Bb H-Mj S-Bb L-Bb 
3g99 X-ray 1.81 B 439-506  H-Bb H-Mj L-Bb 
3g99 X-ray 1.81 A 439-506  H-Bb H-Mj L-Bb 
3fyl X-ray 1.63 B 439-506  H-Bb H-Mj S-Mj L-Bb 
3fyl X-ray 1.63 A 439-506  H-Bb H-Mj L-Bb 
3g97 X-ray 2.08 A 439-506  H-Bb H-Mj L-Bb 
3g97 X-ray 2.08 B 439-506  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text