Pfam domain
Pfam family: PAX (PF00292.20)
Uniprot AC: P06601
RecName: Segmentation protein paired
Begin-End: 28-150
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
QGRVNQLGGVFINGRPLPNNIRLKIVEMAADGIRPCVISRQLRVSHGCVSKILNRYQETG
SIRPGVIGGSKPRIATPEIENRIEEYKRSSPGMFSWEIREKLIREGVCDRSTAPSVSAIS
RLV
Structures of the domain P06601 28-150
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pdn X-ray 2.5 C 2-124  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text