Pfam domain
Pfam family: Topoisom_bac (PF01131.19)
Uniprot AC: P06612
RecName: DNA topoisomerase 1
Begin-End: 156-565
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ELNIDRVNAQQARRFMDRVVGYMVSPLLWKKIARGLSAGRVQSVAVRLVVEREREIKAFV
PEEFWEVDASTTTPSGEALALQVTHQNDKPFRPVNKEQTQAAVSLLEKARYSVLEREDKP
TTSKPGAPFITSTLQQAASTRLGFGVKKTMMMAQRLYEAGYITYMRTDSTNLSQDAVNMV
RGYISDNFGKKYLPESPNQYASKENSQEAHEAIRPSDVNVMAESLKDMEADAQKLYQLIW
RQFVACQMTPAKYDSTTLTVGAGDFRLKARGRILRFDGWTKVMPALRKGDEDRILPAVNK
GDALTLVELTPAQHFTKPPARFSEASLVKELEKRGIGRPSTYASIISTIQDRGYVRVENR
RFYAEKMGEIVTDRLEENFRELMNYDFTAQMENSLDQVANHEAEWKAVLD
Structures of the domain P06612 156-565
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1mw8 X-ray 1.9 X 157-565 None
3px7 X-ray 2.3 A 157-565 None
4rul X-ray 2.9 A 157-565 None


© NPIDB team 2003 - 2019

text