Pfam domain
Pfam family: MMR_HSR1 (PF01926.22)
Uniprot AC: P06616
RecName: GTPase Era
Begin-End: 10-125
Organism: Escherichia coli
Interaction Mode:   

Sequence:
FIAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGAYQAIYVDTPGLHME
EKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLREGKAPVILAVNK
Structures of the domain P06616 10-125
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1x1l X-ray 13.5 X 11-125 None


© NPIDB team 2003 - 2019

text