Pfam domain
Pfam family: BAH (PF01426.17)
Uniprot AC: P06701
RecName: Regulatory protein SIR3
Begin-End: 48-188
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LSFGKGESVIFNDNVTETYSVYLIHEIRLNTLNNVVEIWVFSYLRWFELKPKLYYEQFRP
DLIKEDHPLEFYKDKFFNEVNKSELYLTAELSEIWLKDFIAVGQILPESQWNDSSIDKIE
DRDFLVRYACEPTAEKFVPID
Structures of the domain P06701 48-188
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4jjn X-ray 3.09 L 50-187 None
4jjn X-ray 3.09 K 50-187 None
3tu4 X-ray 3 L 50-187 None
3tu4 X-ray 3 K 50-187 None
3tu4 X-ray 3 K 50-187 None
3tu4 X-ray 3 L 50-187 None
4ld9 X-ray 3.31 L 50-187 None
4ld9 X-ray 3.31 K 50-187 None
4kud X-ray 3.2 L 50-187 None
4kud X-ray 3.2 K 50-187 None


© NPIDB team 2003 - 2020

text