Pfam domain
Pfam family: HHH_8 (PF14716.5)
Uniprot AC: P06746
RecName: DNA polymerase beta
Begin-End: 12-78
Organism: Homo sapiens
Interaction Mode:   

Sequence:
NGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAE
KIDEFLA
Structures of the domain P06746 12-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7icl X-ray 3.1 A 15-77 None
7icq X-ray 2.9 A 15-77 None
3isb X-ray 2 A 15-77 None
4rq4 X-ray 2.1 A 15-77 None
4o5c X-ray 2.36 A 15-77 None
7icu X-ray 3.3 A 15-77 None
9icy X-ray 3 A 15-77 None
8ici X-ray 2.8 A 15-77 None
4klh X-ray 1.88 A 15-77 None
1zqj X-ray 3.3 A 15-77 None
8icq X-ray 3 A 15-77 None
5eoz X-ray 2.09 A 15-77 None
1zqn X-ray 3 A 15-77 None
7icv X-ray 2.8 A 15-77 None
7ici X-ray 2.8 A 15-77 None
2pxi X-ray 2.1 A 15-77 None
9icv X-ray 2.7 A 15-77 None
8ich X-ray 3.3 A 15-77 None
5vs2 X-ray 2.33 A 15-77 None
5tbc X-ray 1.85 A 15-77 None
1zqt X-ray 3.4 A 15-77 None
2p66 X-ray 2.5 A 15-77 None
8icp X-ray 2.9 A 15-77 None
5ugp X-ray 1.96 A 15-77 None
1zqo X-ray 3.2 A 15-77 None
7icr X-ray 3 A 15-77 None
9icc X-ray 3.1 A 15-77 None
3jpn X-ray 2.15 A 15-77 None
1zqk X-ray 3.2 A 15-77 None
3jpo X-ray 2 A 15-77 None
9icp X-ray 3.1 A 15-77 None
8ick X-ray 2.7 A 15-77 None
3rjg X-ray 2 A 15-77 None
9ici X-ray 3.1 A 15-77 None
1zqb X-ray 3.2 A 15-77 None
7icn X-ray 2.8 A 15-77 None
7ice X-ray 2.8 A 15-77 None
2isp X-ray 2.2 A 15-77 None
7ics X-ray 2.8 A 15-77 None
8icx X-ray 3 A 15-77 None
4gxk X-ray 2 A 15-77 None
1zqh X-ray 3.1 A 15-77 None
1zql X-ray 3.3 A 15-77 None
9icg X-ray 3 A 15-77 None
9icr X-ray 3 A 15-77 None
5u2s X-ray 2.3 A 15-77 None
7ict X-ray 2.8 A 15-77 None
3gdx X-ray 2.2 A 15-77 None
9ico X-ray 2.9 A 15-77 None
9icx X-ray 2.6 A 15-77 None
1zqc X-ray 3.2 A 15-77 None
9icq X-ray 2.9 A 15-77 None
8icj X-ray 3.2 A 15-77 None
7icf X-ray 3.1 A 15-77 None
1bpx X-ray 2.4 A 15-77 None
1tva X-ray 2.6 A 15-77 None
9ice X-ray 3.3 A 15-77 None
7ick X-ray 2.9 A 15-77 None
9icf X-ray 3 A 15-77 None
2i9g X-ray 2.1 A 15-77 None
8ica X-ray 3 A 15-77 None
1zqm X-ray 3.2 A 15-77 None
8icy X-ray 3.1 A 15-77 None
5u9h X-ray 1.85 A 15-77 None
3jpp X-ray 2.1 A 15-77 None
1zqi X-ray 2.7 A 15-77 None
1tv9 X-ray 2 A 15-77 None
3jpr X-ray 2.1 A 15-77 None
8icr X-ray 2.9 A 15-77 None
5u2r X-ray 1.8 A 15-77 None
1zqr X-ray 3.7 A 15-77 None
8icv X-ray 3.2 A 15-77 None
5db7 X-ray 2.21 A 15-77 None
2fmp X-ray 1.65 A 15-77 None
8icm X-ray 2.9 A 15-77 None
2iso X-ray 2.1 A 15-77 None
7ich X-ray 2.9 A 15-77 None
3jps X-ray 2 A 15-77 None
3rjh X-ray 2.2 A 15-77 None
1zqf X-ray 2.9 A 15-77 None
9icl X-ray 2.8 A 15-77 None
7icm X-ray 3 A 15-77 None
9ict X-ray 3 A 15-77 None
3jpq X-ray 1.9 A 15-77 None
4nxz X-ray 2.56 A 15-77 None
8ice X-ray 3.2 A 15-77 None
1mq2 X-ray 3.1 A 15-77 None
3jpt X-ray 2.15 A 15-77 None
9ich X-ray 2.9 A 15-77 None
5wo0 X-ray 1.6 A 15-77 None
8icw X-ray 3.3 A 15-77 None
8icc X-ray 2.8 A 15-77 None
5ugn X-ray 2 A 15-77 None
9icj X-ray 3.1 A 15-77 None
1zqa X-ray 3.2 A 15-77 None
2fmq X-ray 2.2 A 15-77 None
1zqs X-ray 3.3 A 15-77 None
1bpz X-ray 2.6 A 15-77 None
9ick X-ray 2.7 A 15-77 None
4pgq X-ray 2.3 A 15-77 None
3c2l X-ray 2.6 A 15-77 None
4klt X-ray 1.98 A 15-77 None
1zqp X-ray 2.8 A 15-77 None
9ics X-ray 2.9 A 15-77 None
8ict X-ray 3.1 A 15-77 None
9icb X-ray 3.2 A 15-77 None
4m47 X-ray 2.37 A 15-77 None
1mq3 X-ray 2.8 A 15-77 None
4php X-ray 2.6 A 15-77 None
8icg X-ray 3.3 A 15-77 None
8ico X-ray 2.7 A 15-77 None
1zqg X-ray 3.1 A 15-77 None
4rq6 X-ray 2.25 A 15-77 None
4nlk X-ray 2.49 A 15-77 None
5hhh X-ray 2.36 A 15-77 None
4m2y X-ray 2.27 A 15-77 None
8icb X-ray 3.1 A 15-77 None
3c2m X-ray 2.15 A 15-77 None
7icj X-ray 3.5 A 15-77 None
7ico X-ray 3.3 A 15-77 None
1zqd X-ray 3.5 A 15-77 None
9icn X-ray 3 A 15-77 None
8icu X-ray 3 A 15-77 None
1zqq X-ray 3.3 A 15-77 None
2fms X-ray 2 A 15-77 None
4klq X-ray 2 A 15-77 None
9ica X-ray 3 A 15-77 None
8icl X-ray 3.1 A 15-77 None
8icz X-ray 3.1 A 15-77 None
8icn X-ray 2.8 A 15-77 None
4tus X-ray 2.42 A 15-77 None
3c2k X-ray 2.4 A 15-77 None
7icp X-ray 3 A 15-77 None
9icu X-ray 2.9 A 15-77 None
1zjm X-ray 2.1 A 15-77 None
3mby X-ray 2 A 15-77 None
8icf X-ray 2.9 A 15-77 None
1zqe X-ray 3.7 A 15-77 None
9icm X-ray 2.9 A 15-77 None
3rjk X-ray 2.1 A 15-77 None
7icg X-ray 3 A 15-77 None
3lk9 X-ray 2.5 A 15-77 None
4mf2 X-ray 2.4 A 15-77 None
8ics X-ray 2.9 A 15-77 None
4lvs X-ray 2 A 15-77 None
5v1p X-ray 1.99 A 15-77 None
5vrz X-ray 2.05 A 15-77 None
3rh4 X-ray 1.92 A 15-77 None
3rh5 X-ray 2.1 A 15-77 None
3rh6 X-ray 2.05 A 15-77 None
4doa X-ray 2.05 A 15-77 None
5bpc X-ray 2 A 15-77 None
3rje X-ray 2.1 A 15-77 None
3rjj X-ray 2 A 15-77 None
3rji X-ray 2.3 A 15-77 None
3rjf X-ray 2.3 A 15-77 None
4rpx X-ray 1.9 A 15-77 None
4doc X-ray 1.95 A 15-77 None
3tfr X-ray 2 A 15-77 None
3tfs X-ray 2 A 15-77 None
5vry X-ray 1.9 A 15-77 None
4mff X-ray 2.55 A 15-77 None
4do9 X-ray 2.05 A 15-77 None
4dob X-ray 2.05 A 15-77 None
4f5q X-ray 2.25 A 15-77 None
4f5p X-ray 1.85 A 15-77 None
4f5n X-ray 1.8 A 15-77 None
4f5r X-ray 2.2 A 15-77 None
4f5r X-ray 2.2 B 15-77 None
4f5o X-ray 2 A 15-77 None
4gxj X-ray 2.2 A 15-77 None
4gxi X-ray 1.95 A 15-77 None
5u2t X-ray 1.79 A 15-77 None
5v1r X-ray 2.08 A 15-77 None
4ph5 X-ray 2.55 A 15-77 None
4tuq X-ray 2.37 A 15-77 None
4rq7 X-ray 2 A 15-77 None
4jwn X-ray 2.39 A 15-77 None
4jwm X-ray 2 A 15-77 None
4nln X-ray 2.26 A 15-77 None
4klm X-ray 1.75 A 15-77 None
4rt3 X-ray 1.92 A 15-77 None
4m9h X-ray 2.39 A 15-77 None
4m9n X-ray 2.27 A 15-77 None
4m9l X-ray 2.09 A 15-77 None
4nm2 X-ray 2.52 A 15-77 None
5v1n X-ray 2.01 A 15-77 None
4nlz X-ray 2.68 A 15-77 None
4nm1 X-ray 2.42 A 15-77 None
4o9m X-ray 2.29 A 15-77 None
4mfc X-ray 2.13 A 15-77 None
4ny8 X-ray 2.25 A 15-77 None
4rq1 X-ray 2.7 A 15-77 None
4klf X-ray 1.85 A 15-77 None
4uaw X-ray 1.9 A 15-77 None
4mf8 X-ray 2.32 A 15-77 None
4mfa X-ray 2.27 A 15-77 None
4r63 X-ray 1.85 A 15-77 None
5v1j X-ray 2.62 A 15-77 None
4ub3 X-ray 2.06 A 15-77 None
5j2j X-ray 2.2 A 15-77 None
4uaz X-ray 1.88 A 15-77 None
5v1h X-ray 1.95 A 15-77 None
4ub4 X-ray 1.95 A 15-77 None
4ub1 X-ray 2.34 A 15-77 None
4ub2 X-ray 2.51 A 15-77 None
4ubb X-ray 1.9 A 15-77 None
5v1f X-ray 2.18 A 15-77 None
4ub5 X-ray 2.15 A 15-77 None
4uay X-ray 1.98 A 15-77 None
5ugo X-ray 1.9 A 15-77 None
4rt2 X-ray 1.92 A 15-77 None
4rq2 X-ray 2.2 A 15-77 None
4rpy X-ray 1.9 A 15-77 None
4o5e X-ray 2.53 A 15-77 None
4rq5 X-ray 2.32 A 15-77 None
4rq0 X-ray 2.2 A 15-77 None
4o5k X-ray 2.06 A 15-77 None
4rq8 X-ray 2 A 15-77 None
4rq3 X-ray 2 A 15-77 None
4rpz X-ray 2.19 A 15-77 None
4ymm X-ray 2.2 A 15-77 None
5v1i X-ray 2.04 A 15-77 None
4phe X-ray 2.15 A 15-77 None
5j2c X-ray 2.1 A 15-77 None
5j2k X-ray 2.1 A 15-77 None
5j0r X-ray 2 A 15-77 None
1zjn X-ray 2.61 A 15-77 None
5j29 X-ray 2.2 A 15-77 None
5vs4 X-ray 1.87 A 15-77 None
4klj X-ray 1.8 A 15-77 None
5j2a X-ray 2.5 A 15-77 None
5db8 X-ray 2.55 A 15-77 None
5j0w X-ray 2.4 A 15-77 None
5dbb X-ray 2.25 A 15-77 None
5j2i X-ray 2.4 A 15-77 None
5j0x X-ray 2 A 15-77 None
4kll X-ray 1.84 A 15-77 None
5j2b X-ray 2.5 A 15-77 None
5dba X-ray 1.97 A 15-77 None
5j2f X-ray 2.1 A 15-77 None
5j2h X-ray 2.3 A 15-77 None
5bom X-ray 2 A 15-77 None
4ubc X-ray 2 A 15-77 None
5j2g X-ray 2.1 A 15-77 None
5dbc X-ray 2.4 A 15-77 None
4tup X-ray 1.8 A 15-77 None
4r65 X-ray 1.95 A 15-77 None
5j2e X-ray 2.1 A 15-77 None
5j2d X-ray 2.1 A 15-77 None
5j0u X-ray 2.1 A 15-77 None
5j0s X-ray 2 A 15-77 None
5tb9 X-ray 2.49 A 15-77 None
5db9 X-ray 2.45 A 15-77 None
5vez X-ray 2.04 A 15-77 None
4p2h X-ray 1.99 A 15-77 None
5vrx X-ray 2.2 A 15-77 None
5j0p X-ray 2.2 A 15-77 None
5j0q X-ray 2 A 15-77 None
5j0y X-ray 2 A 15-77 None
5j0t X-ray 2 A 15-77 None
5tzv X-ray 2 A 15-77 None
4tur X-ray 2.17 A 15-77 None
1bpy X-ray 2.2 A 15-77 None
4kld X-ray 1.92 A 15-77 None
4pgy X-ray 2.26 A 15-77 None
4r64 X-ray 2.2 A 15-77 None
4pha X-ray 2.52 A 15-77 None
4r66 X-ray 2.25 A 15-77 None
5v1o X-ray 1.8 A 15-77 None
5tbb X-ray 2.39 A 15-77 None
5wny X-ray 2.1 A 15-77 None
4pgx X-ray 2.08 A 15-77 None
4z6c X-ray 2.68 A 15-77 None
5vs3 X-ray 1.7 A 15-77 None
4kle X-ray 1.97 A 15-77 None
4klo X-ray 1.85 A 15-77 None
4ppx X-ray 2.08 A 15-77 None
4klg X-ray 1.7 A 15-77 None
4ymn X-ray 2.59 A 15-77 None
5tba X-ray 2.49 A 15-77 None
4phd X-ray 2.21 A 15-77 None
4kli X-ray 1.6 A 15-77 None
5wnx X-ray 2.55 A 15-77 None
5j0o X-ray 2 A 15-77 None
5tb8 X-ray 2 A 15-77 None
4klu X-ray 1.97 A 15-77 None
5v1g X-ray 1.8 A 15-77 None
5wnz X-ray 2.2 A 15-77 None
5vs0 X-ray 2.1 A 15-77 None
4kls X-ray 1.98 A 15-77 None
4m9g X-ray 2.01 A 15-77 None
5vs1 X-ray 2.5 A 15-77 None
4m9j X-ray 2.04 A 15-77 None
3ogu X-ray 1.85 A 15-77 None
5vrw X-ray 2.58 A 15-77 None
9icw X-ray 2.6 A 15-77 None
5bol X-ray 1.98 A 15-77 None
4ymo X-ray 2.15 A 15-77 None
4z6f X-ray 2.44 A 15-77 None
5hhi X-ray 2.52 A 15-77 None
4z6e X-ray 2.75 A 15-77 None
4yn4 X-ray 2.24 A 15-77 None
4z6d X-ray 2.51 A 15-77 None


© NPIDB team 2003 - 2019

text