Pfam domain
Pfam family: DNA_pol_lambd_f (PF10391.8)
Uniprot AC: P06746
RecName: DNA polymerase beta
Begin-End: 98-147
Organism: Homo sapiens
Interaction Mode:  H-Bb L-Bb 

Sequence:
NFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFE
Structures of the domain P06746 98-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7icl X-ray 3.1 A 100-147 None
7icq X-ray 2.9 A 100-147 None
3isb X-ray 2 A 100-147  H-Bb L-Bb 
4rq4 X-ray 2.1 A 100-147  H-Bb L-Bb 
4o5c X-ray 2.36 A 100-147  H-Bb L-Bb 
7icu X-ray 3.3 A 100-147 None
9icy X-ray 3 A 100-147 None
8ici X-ray 2.8 A 100-147 None
4klh X-ray 1.88 A 100-147  H-Bb L-Bb 
1zqj X-ray 3.3 A 100-147 None
8icq X-ray 3 A 100-147 None
5eoz X-ray 2.09 A 100-147  H-Bb L-Bb 
1zqn X-ray 3 A 100-147 None
7icv X-ray 2.8 A 100-147 None
7ici X-ray 2.8 A 100-147 None
2pxi X-ray 2.1 A 100-147 None
9icv X-ray 2.7 A 100-147 None
8ich X-ray 3.3 A 100-147 None
5vs2 X-ray 2.33 A 100-147 None
5tbc X-ray 1.85 A 100-147  H-Bb L-Bb 
1zqt X-ray 3.4 A 100-147 None
2p66 X-ray 2.5 A 100-147  H-Bb L-Bb 
8icp X-ray 2.9 A 100-147 None
5ugp X-ray 1.96 A 100-147  H-Bb L-Bb 
1zqo X-ray 3.2 A 100-147 None
7icr X-ray 3 A 100-147 None
9icc X-ray 3.1 A 100-147 None
3jpn X-ray 2.15 A 100-147 None
1zqk X-ray 3.2 A 100-147 None
3jpo X-ray 2 A 100-147 None
9icp X-ray 3.1 A 100-147 None
8ick X-ray 2.7 A 100-147 None
3rjg X-ray 2 A 100-147 None
9ici X-ray 3.1 A 100-147 None
1zqb X-ray 3.2 A 100-147 None
7icn X-ray 2.8 A 100-147 None
7ice X-ray 2.8 A 100-147 None
2isp X-ray 2.2 A 100-147 None
7ics X-ray 2.8 A 100-147 None
8icx X-ray 3 A 100-147 None
4gxk X-ray 2 A 100-147  H-Bb L-Bb 
1zqh X-ray 3.1 A 100-147 None
1zql X-ray 3.3 A 100-147 None
9icg X-ray 3 A 100-147 None
9icr X-ray 3 A 100-147 None
5u2s X-ray 2.3 A 100-147  H-Bb L-Bb 
7ict X-ray 2.8 A 100-147 None
3gdx X-ray 2.2 A 100-147  H-Bb L-Bb 
9ico X-ray 2.9 A 100-147 None
9icx X-ray 2.6 A 100-147 None
1zqc X-ray 3.2 A 100-147 None
9icq X-ray 2.9 A 100-147 None
8icj X-ray 3.2 A 100-147 None
7icf X-ray 3.1 A 100-147 None
1bpx X-ray 2.4 A 100-147  H-Bb L-Bb 
1tva X-ray 2.6 A 100-147  H-Bb L-Bb 
9ice X-ray 3.3 A 100-147 None
7ick X-ray 2.9 A 100-147 None
9icf X-ray 3 A 100-147 None
2i9g X-ray 2.1 A 100-147 None
8ica X-ray 3 A 100-147 None
1zqm X-ray 3.2 A 100-147 None
8icy X-ray 3.1 A 100-147 None
5u9h X-ray 1.85 A 100-147  H-Bb L-Bb 
3jpp X-ray 2.1 A 100-147 None
1zqi X-ray 2.7 A 100-147 None
1tv9 X-ray 2 A 100-147  H-Bb L-Bb 
3jpr X-ray 2.1 A 100-147 None
8icr X-ray 2.9 A 100-147 None
5u2r X-ray 1.8 A 100-147  H-Bb L-Bb 
1zqr X-ray 3.7 A 100-147 None
8icv X-ray 3.2 A 100-147 None
5db7 X-ray 2.21 A 100-147 None
2fmp X-ray 1.65 A 100-147 None
8icm X-ray 2.9 A 100-147 None
2iso X-ray 2.1 A 100-147 None
7ich X-ray 2.9 A 100-147 None
3jps X-ray 2 A 100-147 None
3rjh X-ray 2.2 A 100-147 None
1zqf X-ray 2.9 A 100-147 None
9icl X-ray 2.8 A 100-147 None
7icm X-ray 3 A 100-147 None
9ict X-ray 3 A 100-147 None
3jpq X-ray 1.9 A 100-147 None
4nxz X-ray 2.56 A 100-147  H-Bb L-Bb 
8ice X-ray 3.2 A 100-147 None
1mq2 X-ray 3.1 A 100-147 None
3jpt X-ray 2.15 A 100-147 None
9ich X-ray 2.9 A 100-147 None
5wo0 X-ray 1.6 A 100-147  H-Bb L-Bb 
8icw X-ray 3.3 A 100-147 None
8icc X-ray 2.8 A 100-147 None
5ugn X-ray 2 A 100-147  H-Bb L-Bb 
9icj X-ray 3.1 A 100-147 None
1zqa X-ray 3.2 A 100-147 None
2fmq X-ray 2.2 A 100-147  H-Bb L-Bb 
1zqs X-ray 3.3 A 100-147 None
1bpz X-ray 2.6 A 100-147  H-Bb L-Bb 
9ick X-ray 2.7 A 100-147 None
4pgq X-ray 2.3 A 100-147  H-Bb L-Bb 
3c2l X-ray 2.6 A 100-147  H-Bb L-Bb 
4klt X-ray 1.98 A 100-147  H-Bb L-Bb 
1zqp X-ray 2.8 A 100-147 None
9ics X-ray 2.9 A 100-147 None
8ict X-ray 3.1 A 100-147 None
9icb X-ray 3.2 A 100-147 None
4m47 X-ray 2.37 A 100-147  H-Bb L-Bb 
1mq3 X-ray 2.8 A 100-147 None
4php X-ray 2.6 A 100-147  H-Bb L-Bb 
8icg X-ray 3.3 A 100-147 None
8ico X-ray 2.7 A 100-147 None
1zqg X-ray 3.1 A 100-147 None
4rq6 X-ray 2.25 A 100-147  H-Bb L-Bb 
4nlk X-ray 2.49 A 100-147  H-Bb L-Bb 
5hhh X-ray 2.36 A 100-147  H-Bb L-Bb 
4m2y X-ray 2.27 A 100-147  H-Bb L-Bb 
8icb X-ray 3.1 A 100-147 None
3c2m X-ray 2.15 A 100-147  H-Bb L-Bb 
7icj X-ray 3.5 A 100-147 None
7ico X-ray 3.3 A 100-147 None
1zqd X-ray 3.5 A 100-147 None
9icn X-ray 3 A 100-147 None
8icu X-ray 3 A 100-147 None
1zqq X-ray 3.3 A 100-147 None
2fms X-ray 2 A 100-147  H-Bb L-Bb 
4klq X-ray 2 A 100-147  H-Bb L-Bb 
9ica X-ray 3 A 100-147 None
8icl X-ray 3.1 A 100-147 None
8icz X-ray 3.1 A 100-147 None
8icn X-ray 2.8 A 100-147 None
4tus X-ray 2.42 A 100-147  H-Bb L-Bb 
3c2k X-ray 2.4 A 100-147  H-Bb L-Bb 
7icp X-ray 3 A 100-147 None
9icu X-ray 2.9 A 100-147 None
1zjm X-ray 2.1 A 100-147 None
3mby X-ray 2 A 100-147 None
8icf X-ray 2.9 A 100-147 None
1zqe X-ray 3.7 A 100-147 None
9icm X-ray 2.9 A 100-147 None
3rjk X-ray 2.1 A 100-147 None
7icg X-ray 3 A 100-147 None
3lk9 X-ray 2.5 A 100-147  H-Bb L-Bb 
4mf2 X-ray 2.4 A 100-147  H-Bb L-Bb 
8ics X-ray 2.9 A 100-147 None
4lvs X-ray 2 A 100-147  H-Bb L-Bb 
5v1p X-ray 1.99 A 100-147 None
5vrz X-ray 2.05 A 100-147 None
3rh4 X-ray 1.92 A 100-147 None
3rh5 X-ray 2.1 A 100-147 None
3rh6 X-ray 2.05 A 100-147 None
4doa X-ray 2.05 A 100-147 None
5bpc X-ray 2 A 100-147  H-Bb L-Bb 
3rje X-ray 2.1 A 100-147  H-Bb L-Bb 
3rjj X-ray 2 A 100-147 None
3rji X-ray 2.3 A 100-147  H-Bb L-Bb 
3rjf X-ray 2.3 A 100-147  H-Bb L-Bb 
4rpx X-ray 1.9 A 100-147  H-Bb L-Bb 
4doc X-ray 1.95 A 100-147 None
3tfr X-ray 2 A 100-147  H-Bb L-Bb 
3tfs X-ray 2 A 100-147  H-Bb L-Bb 
5vry X-ray 1.9 A 100-147 None
4mff X-ray 2.55 A 100-147  H-Bb L-Bb 
4do9 X-ray 2.05 A 100-147 None
4dob X-ray 2.05 A 100-147 None
4f5q X-ray 2.25 A 100-147 None
4f5p X-ray 1.85 A 100-147  H-Bb L-Bb 
4f5n X-ray 1.8 A 100-147  H-Bb L-Bb 
4f5r X-ray 2.2 A 100-147  H-Bb L-Bb 
4f5r X-ray 2.2 B 100-147  H-Bb L-Bb 
4f5o X-ray 2 A 100-147  H-Bb L-Bb 
4gxj X-ray 2.2 A 100-147  H-Bb L-Bb 
4gxi X-ray 1.95 A 100-147  H-Bb L-Bb 
5u2t X-ray 1.79 A 100-147  H-Bb L-Bb 
5v1r X-ray 2.08 A 100-147 None
4ph5 X-ray 2.55 A 100-147 None
4tuq X-ray 2.37 A 100-147  H-Bb L-Bb 
4rq7 X-ray 2 A 100-147  H-Bb L-Bb 
4jwn X-ray 2.39 A 100-147  H-Bb L-Bb 
4jwm X-ray 2 A 100-147  H-Bb L-Bb 
4nln X-ray 2.26 A 100-147  H-Bb L-Bb 
4klm X-ray 1.75 A 100-147  H-Bb L-Bb 
4rt3 X-ray 1.92 A 100-147 None
4m9h X-ray 2.39 A 100-147  H-Bb L-Bb 
4m9n X-ray 2.27 A 100-147  H-Bb L-Bb 
4m9l X-ray 2.09 A 100-147  H-Bb L-Bb 
4nm2 X-ray 2.52 A 100-147 None
5v1n X-ray 2.01 A 100-147 None
4nlz X-ray 2.68 A 100-147  H-Bb L-Bb 
4nm1 X-ray 2.42 A 100-147 None
4o9m X-ray 2.29 A 100-147  H-Bb L-Bb 
4mfc X-ray 2.13 A 100-147  H-Bb L-Bb 
4ny8 X-ray 2.25 A 100-147  H-Bb L-Bb 
4rq1 X-ray 2.7 A 100-147  H-Bb L-Bb 
4klf X-ray 1.85 A 100-147  H-Bb L-Bb 
4uaw X-ray 1.9 A 100-147  H-Bb L-Bb 
4mf8 X-ray 2.32 A 100-147  H-Bb L-Bb 
4mfa X-ray 2.27 A 100-147  H-Bb L-Bb 
4r63 X-ray 1.85 A 100-147  H-Bb L-Bb 
5v1j X-ray 2.62 A 100-147 None
4ub3 X-ray 2.06 A 100-147  H-Bb L-Bb 
5j2j X-ray 2.2 A 100-147 None
4uaz X-ray 1.88 A 100-147  H-Bb L-Bb 
5v1h X-ray 1.95 A 100-147 None
4ub4 X-ray 1.95 A 100-147  H-Bb L-Bb 
4ub1 X-ray 2.34 A 100-147  H-Bb L-Bb 
4ub2 X-ray 2.51 A 100-147  H-Bb L-Bb 
4ubb X-ray 1.9 A 100-147  H-Bb L-Bb 
5v1f X-ray 2.18 A 100-147 None
4ub5 X-ray 2.15 A 100-147  H-Bb L-Bb 
4uay X-ray 1.98 A 100-147  H-Bb L-Bb 
5ugo X-ray 1.9 A 100-147  H-Bb L-Bb 
4rt2 X-ray 1.92 A 100-147 None
4rq2 X-ray 2.2 A 100-147  H-Bb L-Bb 
4rpy X-ray 1.9 A 100-147  H-Bb L-Bb 
4o5e X-ray 2.53 A 100-147  H-Bb L-Bb 
4rq5 X-ray 2.32 A 100-147  H-Bb L-Bb 
4rq0 X-ray 2.2 A 100-147  H-Bb L-Bb 
4o5k X-ray 2.06 A 100-147  H-Bb L-Bb 
4rq8 X-ray 2 A 100-147  H-Bb L-Bb 
4rq3 X-ray 2 A 100-147  H-Bb L-Bb 
4rpz X-ray 2.19 A 100-147  H-Bb L-Bb 
4ymm X-ray 2.2 A 100-147  H-Bb L-Bb 
5v1i X-ray 2.04 A 100-147 None
4phe X-ray 2.15 A 100-147  H-Bb L-Bb 
5j2c X-ray 2.1 A 100-147 None
5j2k X-ray 2.1 A 100-147 None
5j0r X-ray 2 A 100-147 None
1zjn X-ray 2.61 A 100-147 None
5j29 X-ray 2.2 A 100-147 None
5vs4 X-ray 1.87 A 100-147 None
4klj X-ray 1.8 A 100-147  H-Bb L-Bb 
5j2a X-ray 2.5 A 100-147 None
5db8 X-ray 2.55 A 100-147 None
5j0w X-ray 2.4 A 100-147 None
5dbb X-ray 2.25 A 100-147 None
5j2i X-ray 2.4 A 100-147 None
5j0x X-ray 2 A 100-147 None
4kll X-ray 1.84 A 100-147  H-Bb L-Bb 
5j2b X-ray 2.5 A 100-147 None
5dba X-ray 1.97 A 100-147 None
5j2f X-ray 2.1 A 100-147 None
5j2h X-ray 2.3 A 100-147 None
5bom X-ray 2 A 100-147  H-Bb L-Bb 
4ubc X-ray 2 A 100-147  H-Bb L-Bb 
5j2g X-ray 2.1 A 100-147 None
5dbc X-ray 2.4 A 100-147 None
4tup X-ray 1.8 A 100-147  H-Bb L-Bb 
4r65 X-ray 1.95 A 100-147  H-Bb L-Bb 
5j2e X-ray 2.1 A 100-147 None
5j2d X-ray 2.1 A 100-147 None
5j0u X-ray 2.1 A 100-147 None
5j0s X-ray 2 A 100-147 None
5tb9 X-ray 2.49 A 100-147  H-Bb L-Bb 
5db9 X-ray 2.45 A 100-147 None
5vez X-ray 2.04 A 100-147 None
4p2h X-ray 1.99 A 100-147  H-Bb L-Bb 
5vrx X-ray 2.2 A 100-147 None
5j0p X-ray 2.2 A 100-147 None
5j0q X-ray 2 A 100-147 None
5j0y X-ray 2 A 100-147 None
5j0t X-ray 2 A 100-147 None
5tzv X-ray 2 A 100-147 None
4tur X-ray 2.17 A 100-147  H-Bb L-Bb 
1bpy X-ray 2.2 A 100-147 None
4kld X-ray 1.92 A 100-147  H-Bb L-Bb 
4pgy X-ray 2.26 A 100-147 None
4r64 X-ray 2.2 A 100-147  H-Bb L-Bb 
4pha X-ray 2.52 A 100-147  H-Bb L-Bb 
4r66 X-ray 2.25 A 100-147  H-Bb L-Bb 
5v1o X-ray 1.8 A 100-147 None
5tbb X-ray 2.39 A 100-147  H-Bb L-Bb 
5wny X-ray 2.1 A 100-147  H-Bb L-Bb 
4pgx X-ray 2.08 A 100-147  H-Bb L-Bb 
4z6c X-ray 2.68 A 100-147 None
5vs3 X-ray 1.7 A 100-147 None
4kle X-ray 1.97 A 100-147  H-Bb L-Bb 
4klo X-ray 1.85 A 100-147  H-Bb L-Bb 
4ppx X-ray 2.08 A 100-147  H-Bb L-Bb 
4klg X-ray 1.7 A 100-147  H-Bb L-Bb 
4ymn X-ray 2.59 A 100-147  H-Bb L-Bb 
5tba X-ray 2.49 A 100-147  H-Bb L-Bb 
4phd X-ray 2.21 A 100-147  H-Bb L-Bb 
4kli X-ray 1.6 A 100-147  H-Bb L-Bb 
5wnx X-ray 2.55 A 100-147  H-Bb L-Bb 
5j0o X-ray 2 A 100-147 None
5tb8 X-ray 2 A 100-147  H-Bb L-Bb 
4klu X-ray 1.97 A 100-147  H-Bb L-Bb 
5v1g X-ray 1.8 A 100-147 None
5wnz X-ray 2.2 A 100-147  H-Bb L-Bb 
5vs0 X-ray 2.1 A 100-147 None
4kls X-ray 1.98 A 100-147  H-Bb L-Bb 
4m9g X-ray 2.01 A 100-147  H-Bb L-Bb 
5vs1 X-ray 2.5 A 100-147 None
4m9j X-ray 2.04 A 100-147  H-Bb L-Bb 
3ogu X-ray 1.85 A 99-147 None
5vrw X-ray 2.58 A 100-147 None
9icw X-ray 2.6 A 100-147 None
5bol X-ray 1.98 A 100-147  H-Bb L-Bb 
4ymo X-ray 2.15 A 100-147  H-Bb L-Bb 
4z6f X-ray 2.44 A 100-147  H-Bb L-Bb 
5hhi X-ray 2.52 A 100-147  H-Bb L-Bb 
4z6e X-ray 2.75 A 100-147  H-Bb L-Bb 
4yn4 X-ray 2.24 A 100-147  H-Bb L-Bb 
4z6d X-ray 2.51 A 100-147  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text