Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.8)
Uniprot AC: P06766
RecName: DNA polymerase beta
Begin-End: 268-334
Organism: Rattus norvegicus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 

Sequence:
GVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRY
REPKDRS
Structures of the domain P06766 268-334
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1huo X-ray 2.6 A 268-334  H-Bb L-Bb 
1huo X-ray 2.6 B 268-334  H-Bb H-Mn L-Bb 
2bpf X-ray 2.9 A 268-334  H-Bb H-Mn S-Bb L-Bb 
2bpg X-ray 3.6 A 268-334  H-Bb S-Bb 
2bpg X-ray 3.6 B 268-334  H-Bb H-Mn L-Bb 
3v7j X-ray 2.25 A 268-334 None
1huz X-ray 2.6 A 268-334  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1huz X-ray 2.6 B 268-334  H-Bb H-Mj H-Mn L-Bb L-Mn 
3v72 X-ray 2.49 A 268-334 None
3uxp X-ray 2.72 A 268-334  L-Bb 
3uxp X-ray 2.72 B 268-334  H-Bb S-Bb 
3v7k X-ray 2.27 A 268-334 None


© NPIDB team 2003 - 2021

text