Pfam domain
Pfam family: TOPRIM_C (PF16898.4)
Uniprot AC: P06786
RecName: DNA topoisomerase 2
Begin-End: 559-688
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb 

Sequence:
FITPIIKVSITKPTKNTIAFYNMPDYEKWREEESHKFTWKQKYYKGLGTSLAQEVREYFS
NLDRHLKIFHSLQGNDKDYIDLAFSKKKADDRKEWLRQYEPGTVLDPTLKEIPISDFINK
ELILFSLADN
Structures of the domain P06786 559-688
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l4k X-ray 2.98 A 559-688 None
4gfh X-ray 4.41 F 559-688  H-Bb 
4gfh X-ray 4.41 A 559-688  H-Bb 
2rgr X-ray 3 A 559-688  H-Bb 
3l4j X-ray 2.48 A 559-688 None


© NPIDB team 2003 - 2019

text