Pfam domain
Pfam family: DNA_topoisoIV (PF00521.19)
Uniprot AC: P06786
RecName: DNA topoisomerase 2
Begin-End: 690-1160
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Mj S-Bb S-Mj S-Mn L-Bb 

Sequence:
RSIPNVLDGFKPGQRKVLYGCFKKNLKSELKVAQLAPYVSECTAYHHGEQSLAQTIIGLA
QNFVGSNNIYLLLPNGAFGTRATGGKDAAAARYIYTELNKLTRKIFHPADDPLYKYIQED
EKTVEPEWYLPILPMILVNGAEGIGTGWSTYIPPFNPLEIIKNIRHLMNDEELEQMHPWF
RGWTGTIEEIEPLRYRMYGRIEQIGDNVLEITELPARTWTSTIKEYLLLGLSGNDKIKPW
IKDMEEQHDDNIKFIITLSPEEMAKTRKIGFYERFKLISPISLMNMVAFDPHGKIKKYNS
VNEILSEFYYVRLEYYQKRKDHMSERLQWEVEKYSFQVKFIKMIIEKELTVTNKPRNAII
QELENLGFPRFNKEGKPYYGSPNDEIAEQINDVKGATSDEEDEESSHEDTENVINGPEEL
YGTYEYLLGMRIWSLTKERYQKLLKQKQEKETELENLLKLSAKDIWNTDLK
Structures of the domain P06786 690-1160
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l4k X-ray 2.98 A 690-1160 None
4gfh X-ray 4.41 F 690-1160  H-Mj S-Bb S-Mj S-Mn L-Bb 
4gfh X-ray 4.41 A 690-1160  H-Mj S-Bb S-Mj S-Mn L-Bb 
2rgr X-ray 3 A 690-1160  S-Bb S-Mj S-Mn L-Bb 
3l4j X-ray 2.48 A 690-1160 None


© NPIDB team 2003 - 2019

text