Pfam domain
Pfam family: PPV_E2_C (PF00511.16)
Uniprot AC: P06790
RecName: Regulatory protein E2
Begin-End: 288-363
Organism: Human papillomavirus type 18
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
PIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTGAGNEKTGILTVTYHSETQRTKFL
NTVAIPDSVQILVGYM
Structures of the domain P06790 288-363
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1jj4 X-ray 2.4 B 288-361  H-Bb H-Mj S-Bb L-Bb 
1jj4 X-ray 2.4 A 288-361  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2019

text