Pfam domain
Pfam family: Myb_DNA-binding (PF00249.30)
Uniprot AC: P06876
RecName: Transcriptional activator Myb
Begin-End: 92-138
Organism: Mus musculus
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
KGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHL
Structures of the domain P06876 92-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1msf NMR C 92-138  H-Bb H-Mj L-Bb 
1mse NMR C 92-138  H-Bb H-Mj L-Bb 
1h88 X-ray 2.8 C 92-138  H-Bb H-Mj L-Bb 
1h89 X-ray 2.45 C 92-138  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2020

text