Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P06897
RecName: Histone H2A type 1
Begin-End: 13-91
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb 

Sequence:
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR
DNKKTRIIPRHLQLAVRND
Structures of the domain P06897 13-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1p3f X-ray 2.9 G 1017-1088  H-Bb S-Bb 
1p3f X-ray 2.9 C 818-888  H-Bb S-Bb 
3kwq X-ray 3.5 G 18-88  H-Bb S-Bb L-Bb 
3kwq X-ray 3.5 C 18-88  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 G 1019-1088  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 C 818-888  H-Bb S-Bb L-Bb 
1kx4 X-ray 2.6 C 19-88 None
1kx4 X-ray 2.6 G 18-88 None
4j8v X-ray 2.58 C 18-88 None
4j8v X-ray 2.58 G 18-88 None
4j8v X-ray 2.58 C 18-88 None
4j8v X-ray 2.58 G 18-88 None
3c1c X-ray 3.15 C 818-888  H-Bb 
3c1c X-ray 3.15 G 1019-1088  H-Bb S-Bb L-Bb 
1kx3 X-ray 2 G 18-88 None
1kx3 X-ray 2 C 18-88 None
3c1b X-ray 2.2 G 1019-1088  H-Bb S-Bb L-Bb 
3c1b X-ray 2.2 C 818-888  H-Bb S-Bb L-Bb 
1p34 X-ray 2.7 C 816-888  H-Bb S-Bb L-Bb 
1p34 X-ray 2.7 G 1017-1088  H-Bb S-Bb L-Bb 
3uta X-ray 2.07 G 18-88 None
3uta X-ray 2.07 C 18-88 None
3utb X-ray 2.2 G 18-88 None
3utb X-ray 2.2 C 19-88 None
1p3g X-ray 2.7 C 818-888  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 G 1016-1088  H-Bb S-Bb L-Bb 
4j8x X-ray 2.87 C 18-88 None
4j8x X-ray 2.87 G 18-88 None
4j8x X-ray 2.87 C 18-88 None
4j8x X-ray 2.87 G 18-88 None
1p3a X-ray 3 G 1019-1088  H-Bb S-Bb L-Bb 
1p3a X-ray 3 C 818-888  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 G 1018-1088  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 C 818-888  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 G 1018-1088  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 C 818-888  H-Bb S-Bb L-Bb 
3kuy X-ray 2.9 G 18-88 None
3kuy X-ray 2.9 C 18-88 None
1p3p X-ray 2.7 C 818-888  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 G 1016-1088  H-Bb S-Bb L-Bb 
3b6f X-ray 3.45 G 17-88 None
3b6f X-ray 3.45 C 18-88 None
1p3b X-ray 3 G 1018-1088  H-Bb S-Bb L-Bb 
1p3b X-ray 3 C 817-888  H-Bb S-Bb 
3tu4 X-ray 3 G 16-88  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 C 16-88  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 G 16-88  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 C 16-88  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 G 1018-1088  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 C 818-888  H-Bb L-Bb 
1m1a X-ray 2.65 G 1018-1088  H-Bb S-Bb S-Mn L-Bb 
1m1a X-ray 2.65 C 818-888  H-Bb S-Bb L-Bb 
3b6g X-ray 3.45 G 17-88 None
3b6g X-ray 3.45 C 18-88 None
2nzd X-ray 2.65 G 18-88 None
2nzd X-ray 2.65 C 18-88 None
1aoi X-ray 2.8 G 16-88  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 G 1015-1088  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 C 818-888  H-Bb S-Bb L-Bb 
3o62 X-ray 3.22 G 18-88  H-Bb S-Bb L-Bb 
3o62 X-ray 3.22 C 18-88  H-Bb S-Bb L-Bb 
1s32 X-ray 2.05 G 1017-1088  H-Bb S-Bb L-Bb 
1s32 X-ray 2.05 C 816-888  H-Bb S-Bb L-Bb 
2fj7 X-ray 3.2 G 18-88  H-Bb S-Bb L-Bb 
2fj7 X-ray 3.2 C 18-88  H-Bb L-Bb 
1m19 X-ray 2.3 G 1018-1088  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 C 818-888  H-Bb S-Bb L-Bb 
3rek X-ray 2.6 G 18-88 None
3rek X-ray 2.6 C 19-88 None
5x0x X-ray 3.97 G 16-88  H-Bb S-Bb L-Bb 
5x0x X-ray 3.97 C 16-88  H-Bb S-Bb 
3reh X-ray 2.5 G 18-88 None
3reh X-ray 2.5 C 18-88 None
3rel X-ray 2.7 G 18-88 None
3rel X-ray 2.7 C 19-88 None
3rej X-ray 2.55 G 18-88 None
3rej X-ray 2.55 C 19-88 None
1zla X-ray 2.9 G 1018-1088  H-Bb S-Bb L-Bb 
1zla X-ray 2.9 C 818-888  H-Bb S-Bb L-Bb 
3rei X-ray 2.65 G 18-88 None
3rei X-ray 2.65 C 18-88 None
3ut9 X-ray 2.2 G 19-88 None
3ut9 X-ray 2.2 C 18-88 None
1m18 X-ray 2.45 G 1018-1088  H-Bb S-Bb L-Bb 
1m18 X-ray 2.45 C 818-888  H-Bb S-Bb L-Bb 
4j8u X-ray 2.38 G 18-88 None
4j8u X-ray 2.38 C 18-88 None
4j8u X-ray 2.38 G 18-88 None
4j8u X-ray 2.38 C 18-88 None
3lja X-ray 2.75 G 17-88 None
3lja X-ray 2.75 C 18-88 None
4r8p X-ray 3.28 G 16-88 None
5x0y X-ray 4.69 G 16-88  H-Bb S-Bb L-Bb 
5x0y X-ray 4.69 C 16-88  H-Bb S-Bb L-Bb 
5f99 X-ray 2.63 G 13-88 None
5f99 X-ray 2.63 C 15-88 None
3mnn X-ray 2.5 G 18-88 None
3mnn X-ray 2.5 C 18-88 None
4j8w X-ray 2.41 G 18-88 None
4j8w X-ray 2.41 C 18-88 None
4j8w X-ray 2.41 C 18-88 None
4j8w X-ray 2.41 G 18-88 None


© NPIDB team 2003 - 2019

text