Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P06897
RecName: Histone H2A type 1
Begin-End: 19-91
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
SSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTR
IIPRHLQLAVRND
Structures of the domain P06897 19-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5omx X-ray 2.32 G 19-88 None
5omx X-ray 2.32 C 18-88 None
4xzq X-ray 2.4 G 1018-1088  H-Bb S-Bb L-Bb 
4xzq X-ray 2.4 C 818-888  H-Bb S-Bb L-Bb 
4wu9 X-ray 2.6 G 18-88 None
4wu9 X-ray 2.6 C 18-88 None
4ys3 X-ray 3 C 818-888  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 G 1018-1088  H-Bb S-Bb L-Bb 
5nl0 X-ray 5.4 C 18-88 None
5nl0 X-ray 5.4 G 19-88 None
5nl0 X-ray 5.4 M 18-88 None
5mlu X-ray 2.8 G 18-88 None
5mlu X-ray 2.8 C 19-88 None
5ong X-ray 2.8 G 18-88 None
5ong X-ray 2.8 C 18-88 None
4ld9 X-ray 3.31 G 22-88 None
4ld9 X-ray 3.31 C 23-88 None
4r8p X-ray 3.28 C 19-88 None
5onw X-ray 2.8 G 18-88 None
5onw X-ray 2.8 C 18-88 None
5e5a X-ray 2.81 G 18-88  H-Bb S-Bb L-Bb 
5e5a X-ray 2.81 C 18-88  H-Bb S-Bb L-Bb 
5xf6 X-ray 2.63 G 18-88 None
5xf6 X-ray 2.63 C 18-88 None
4wu8 X-ray 2.45 G 18-88 None
4wu8 X-ray 2.45 C 18-88 None
4zux X-ray 3.82 G 18-88 None
4zux X-ray 3.82 C 4-73 None
4zux X-ray 3.82 Q 18-88 None
4zux X-ray 3.82 M 4-73 None
5dnm X-ray 2.81 G 18-88 None
5dnm X-ray 2.81 C 18-88 None
4xuj X-ray 3.18 G 18-88 None
4xuj X-ray 3.18 C 18-88 None
5o9g X-ray 4.8 G 18-88 None
5o9g X-ray 4.8 C 19-88 None
4z66 X-ray 2.5 G 1018-1088  H-Bb S-Bb L-Bb 
4z66 X-ray 2.5 C 818-888  H-Bb S-Bb L-Bb 
5dnn X-ray 2.8 G 18-88 None
5dnn X-ray 2.8 C 18-88 None
5cp6 X-ray 2.6 G 18-88 None
5cp6 X-ray 2.6 C 18-88 None


© NPIDB team 2003 - 2019

text