Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P06897
RecName: Histone H2A type 1
Begin-End: 5-91
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
GKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRND
Structures of the domain P06897 5-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1kx5 X-ray 1.94 G 4-88 None
1kx5 X-ray 1.94 C 4-88 None
1aoi X-ray 2.8 C 7-88  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2019

text