Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P06899
RecName: Histone H2B type 1-J
Begin-End: 28-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
KKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKR
STITSREIQTAVRLL
Structures of the domain P06899 28-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jrg X-ray 2.5 D 27-100  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2019

text