Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: P06899
RecName: Histone H2B type 1-J
Begin-End: 33-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P06899 33-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xf4 X-ray 2.87 D 29-97 None
5xf4 X-ray 2.87 H 29-97 None
5x7x X-ray 2.18 H 35-100  H-Bb H-Mj S-Bb L-Bb 
5x7x X-ray 2.18 D 33-100  H-Bb H-Mj S-Bb L-Bb 
3azl X-ray 2.7 H 33-100  H-Bb L-Bb 
3azl X-ray 2.7 D 32-100  H-Bb H-Mj S-Bb L-Bb 
5av9 X-ray 2.2 H 32-100 None
5av9 X-ray 2.2 D 30-100 None
5b40 X-ray 3.33 H 35-100  H-Bb 
5b40 X-ray 3.33 D 33-100  H-Bb H-Mj 
5ay8 X-ray 2.8 H 34-100  H-Bb S-Bb L-Bb 
5ay8 X-ray 2.8 D 34-100  H-Bb H-Mj S-Bb L-Bb 
3azg X-ray 2.4 H 33-100  H-Bb S-Bb L-Bb 
3azg X-ray 2.4 D 32-100  H-Bb H-Mj S-Bb L-Bb 
3w98 X-ray 3.42 H 34-100  H-Bb L-Bb 
3w98 X-ray 3.42 D 30-100  H-Bb H-Mj L-Bb 
3waa X-ray 3.2 H 34-100  H-Bb S-Bb L-Bb 
3waa X-ray 3.2 D 32-100  H-Bb H-Mj S-Bb L-Bb 
3afa X-ray 2.5 H 34-100  H-Bb H-Mj S-Bb L-Bb 
3afa X-ray 2.5 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3av1 X-ray 2.5 H 34-100  H-Bb H-Mj S-Bb L-Bb 
3av1 X-ray 2.5 D 33-100  H-Bb H-Mj S-Bb L-Bb 
3azi X-ray 2.7 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3azi X-ray 2.7 H 33-100 None
3av2 X-ray 2.8 H 34-100  H-Bb L-Bb 
3av2 X-ray 2.8 D 32-100  H-Bb H-Mj S-Bb L-Bb 
3azf X-ray 2.7 H 34-100  H-Bb L-Bb 
3azf X-ray 2.7 D 32-100  H-Bb H-Mj S-Bb L-Bb 
3aze X-ray 3 D 32-100  H-Bb H-Mj S-Bb L-Bb 
3aze X-ray 3 H 34-100  H-Bb H-Mj S-Bb L-Bb 
3azj X-ray 2.89 H 33-100  H-Bb L-Bb 
3azj X-ray 2.89 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3azk X-ray 3.2 H 33-100  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3azm X-ray 2.89 H 34-100  H-Bb H-Mj S-Bb L-Bb 
3azm X-ray 2.89 D 30-100  H-Bb H-Mj L-Bb 
3ayw X-ray 2.9 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3ayw X-ray 2.9 H 34-100  H-Bb L-Bb 
3azn X-ray 3 H 33-100  H-Bb S-Bb L-Bb 
3azn X-ray 3 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3a6n X-ray 2.7 H 33-100  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 D 32-100  H-Bb H-Mj S-Bb L-Bb 
3an2 X-ray 3.6 H 36-100 None
3an2 X-ray 3.6 D 36-100 None
3azh X-ray 3.49 H 34-100  H-Bb L-Bb 
3azh X-ray 3.49 D 30-100  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wa9 X-ray 3.07 H 33-100  H-Bb H-Mj S-Bb L-Bb L-Mn 
3wa9 X-ray 3.07 D 33-100  H-Bb H-Mj S-Bb L-Bb 
3w96 X-ray 3 H 34-100  H-Bb H-Mj 
3w96 X-ray 3 D 30-100  H-Bb H-Mj 
3w97 X-ray 3.2 H 34-100  H-Bb L-Bb 
3w97 X-ray 3.2 D 33-100  H-Bb H-Mj S-Bb L-Bb 
5xf3 X-ray 2.6 H 29-97 None
5xf3 X-ray 2.6 D 29-97 None
3wtp X-ray 2.67 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3wtp X-ray 2.67 H 33-100  H-Bb S-Bb L-Bb 
5av6 X-ray 2.2 D 30-100 None
5av6 X-ray 2.2 H 32-100 None
5cpi X-ray 2.9 H 34-100  H-Bb L-Bb 
5cpi X-ray 2.9 D 33-100  H-Bb S-Bb L-Bb L-Mn 
5b33 X-ray 2.93 H 34-100  H-Bb S-Bb L-Bb 
5b33 X-ray 2.93 D 34-100  H-Bb H-Mj S-Bb L-Bb 
5cpk X-ray 2.63 H 35-100 None
5cpk X-ray 2.63 D 33-100 None
4ym6 X-ray 3.51 H 34-100  H-Bb 
4ym6 X-ray 3.51 D 30-100  H-Bb H-Mj S-Bb L-Bb 
5b0z X-ray 1.99 H 35-100  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 D 32-100  H-Bb H-Mj S-Bb L-Bb 
5b2j X-ray 2.6 H 29-97 None
5b2j X-ray 2.6 D 27-97 None
5gxq X-ray 2.85 H 34-100  H-Bb L-Bb 
5gxq X-ray 2.85 D 30-100  H-Bb H-Mj S-Bb L-Bb 
4ym5 X-ray 4.01 D 33-100  H-Bb H-Mj S-Bb L-Bb 
4ym5 X-ray 4.01 H 30-100  H-Bb H-Mj S-Bb L-Bb L-Mn 
5av8 X-ray 2.2 H 32-100 None
5av8 X-ray 2.2 D 30-100 None
5gtc X-ray 2.7 H 34-100  H-Bb H-Mj S-Bb L-Bb 
5gtc X-ray 2.7 D 33-100  H-Bb H-Mj L-Bb L-Mn 
5b24 X-ray 3.6 H 34-100  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 D 33-100  H-Bb H-Mj S-Bb L-Bb 
4z5t X-ray 2.8 H 34-100  H-Bb H-Mj L-Bb 
4z5t X-ray 2.8 D 34-100  H-Bb H-Mj S-Bb L-Bb 
5av5 X-ray 2.4 D 30-100 None
5av5 X-ray 2.4 H 32-100 None
5b2i X-ray 3 H 29-97 None
5b2i X-ray 3 D 27-97 None
5gse X-ray 3.14 N 33-100  H-Bb S-Bb L-Bb L-Mn 
5gse X-ray 3.14 H 35-100  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 D 33-100  H-Bb L-Bb 
5b0y X-ray 2.56 H 34-100  H-Bb H-Mj S-Bb L-Bb 
5b0y X-ray 2.56 D 33-100  H-Bb H-Mj S-Bb L-Bb 
5cpj X-ray 3.15 H 34-100 None
5cpj X-ray 3.15 D 33-100 None
5avb X-ray 2.4 H 32-100 None
5avb X-ray 2.4 D 30-100 None
6etx X-ray 4.8 P 32-100 None
6etx X-ray 4.8 L 30-100 None
5avc X-ray 2.4 H 32-100 None
5avc X-ray 2.4 D 30-100 None
5b32 X-ray 2.35 H 35-100  H-Bb H-Mj S-Bb L-Bb 
5b32 X-ray 2.35 D 33-100  H-Bb H-Mj S-Bb L-Bb 
6buz X-ray 3.92 H 33-101 None
6buz X-ray 3.92 D 33-101 None
5xf5 X-ray 2.82 H 29-97 None
5xf5 X-ray 2.82 D 29-97 None
5b31 X-ray 2.2 H 35-100  H-Bb S-Bb L-Bb 
5b31 X-ray 2.2 D 33-100  H-Bb H-Mj S-Bb L-Bb 
5jrg X-ray 2.5 H 30-100  H-Bb H-Mj S-Bb L-Bb 
3w99 X-ray 3 D 30-100  H-Bb H-Mj S-Bb L-Bb 
3w99 X-ray 3 H 34-100  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text