Pfam domain
Pfam family: Phage_integrase (PF00589.24)
Uniprot AC: P06956
RecName: Recombinase cre
Begin-End: 138-314
Organism: Escherichia phage P1
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
ERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHI
GRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLS
TRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGG
Structures of the domain P06956 138-314
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5crx X-ray 2.7 B 138-314  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text