Pfam domain
Pfam family: Phage_integrase (PF00589.21)
Uniprot AC: P06956
RecName: Recombinase cre
Begin-End: 138-330
Organism: Escherichia phage P1
Interaction Mode:  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 

Sequence:
ERTDFDQVRSLMENSDRCQDIRNLAFLGIAYNTLLRIAEIARIRVKDISRTDGGRMLIHI
GRTKTLVSTAGVEKALSLGVTKLVERWISVSGVADDPNNYLFCRVRKNGVAAPSATSQLS
TRALEGIFEATHRLIYGAKDDSGQRYLAWSGHSARVGAARDMARAGVSIPEIMQAGGWTN
VNIVMNYIRNLDS
Structures of the domain P06956 138-330
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ma7 X-ray 2.3 B 139-327  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1ma7 X-ray 2.3 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4crx X-ray 2.2 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4crx X-ray 2.2 B 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1nzb X-ray 3.1 B 139-329  H-Bb H-Mj L-Bb L-Mj L-Mn 
1nzb X-ray 3.1 F 139-329  H-Bb H-Mj L-Bb L-Mj L-Mn 
1nzb X-ray 3.1 E 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1nzb X-ray 3.1 A 139-329  H-Bb H-Mj L-Bb L-Mj L-Mn 
3c29 X-ray 2.2 H 139-329  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
3c29 X-ray 2.2 A 139-329  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
3c29 X-ray 2.2 B 139-329  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
3c29 X-ray 2.2 G 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1q3v X-ray 2.91 E 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1q3v X-ray 2.91 B 139-329  H-Bb H-Mj L-Bb 
1q3v X-ray 2.91 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1q3v X-ray 2.91 F 139-329  H-Bb H-Mj L-Bb 
1kbu X-ray 2.2 B 139-327  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1kbu X-ray 2.2 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1xns X-ray 2.8 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1xns X-ray 2.8 B 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1q3u X-ray 2.9 F 139-329  H-Bb H-Mj L-Bb L-Mj L-Mn 
1q3u X-ray 2.9 A 139-329  H-Bb H-Mj L-Bb L-Mj L-Mn 
1q3u X-ray 2.9 B 139-329  H-Bb H-Mj L-Bb L-Mj L-Mn 
1q3u X-ray 2.9 E 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1xo0 X-ray 2 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1xo0 X-ray 2 B 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1crx X-ray 2.4 B 139-329  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
1crx X-ray 2.4 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1ouq X-ray 3.2 F 139-329  H-Bb H-Mj L-Bb 
1ouq X-ray 3.2 A 139-329  H-Bb H-Mj L-Bb L-Mj L-Mn 
1ouq X-ray 3.2 B 139-329 None
1ouq X-ray 3.2 E 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
2crx X-ray 2.5 B 139-326  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
2crx X-ray 2.5 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3crx X-ray 2.5 A 139-329 None
3crx X-ray 2.5 B 139-329 None
1pvr X-ray 2.65 B 139-327  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
1pvr X-ray 2.65 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
5crx X-ray 2.7 A 139-316  H-Bb H-Mj L-Bb L-Mj L-Mn 
3mgv X-ray 2.29 D 139-329  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
3mgv X-ray 2.29 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3mgv X-ray 2.29 C 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3mgv X-ray 2.29 B 139-329  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
1f44 X-ray 2.05 A 139-328  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
1pvp X-ray 2.35 B 139-326  H-Bb H-Mj L-Bb L-Mn 
1pvp X-ray 2.35 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mn 
1drg X-ray 2.55 A 139-328  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
1pvq X-ray 2.75 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mn 
1pvq X-ray 2.75 B 139-327  H-Bb H-Mj S-Bb L-Bb L-Mn 
2hof X-ray 2.4 B 139-334  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
2hof X-ray 2.4 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
2hoi X-ray 2.6 H 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
2hoi X-ray 2.6 G 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
2hoi X-ray 2.6 B 139-329  H-Bb H-Mj S-Bb S-Mn L-Bb L-Mj L-Mn 
2hoi X-ray 2.6 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3c28 X-ray 2.6 B 139-326  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
3c28 X-ray 2.6 A 139-329  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text