Pfam domain
Pfam family: RrnaAD (PF00398.19)
Uniprot AC: P06992
RecName: Ribosomal RNA small subunit methyltransferase A
Begin-End: 17-266
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QNFLNDQFVIDSIVSAINPQKGQAMVEIGPGLAALTEPVGERLDQLTVIELDRDLAARLQ
THPFLGPKLTIYQQDAMTFNFGELAEKMGQPLRVFGNLPYNISTPLMFHLFSYTDAIADM
HFMLQKEVVNRLVAGPNSKAYGRLSVMAQYYCNVIPVLEVPPSAFTPPPKVDSAVVRLVP
HATMPHPVKDVRVLSRITTEAFNQRRKTIRNSLGNLFSVEVLTGMGIDPAMRAENISVAQ
YCQMANYLAE
Structures of the domain P06992 17-266
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4adv X-ray 13.5 V 17-265 None


© NPIDB team 2003 - 2019

text