Pfam domain
Pfam family: PCRF (PF03462.17)
Uniprot AC: P07012
RecName: Peptide chain release factor RF2
Begin-End: 127-220
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DCYLDIQAGSGGTEAQDWASMLERMYLRWAESRGFKTEIIEESEGEVAGIKSVTIKISGD
YAYGWLRTETGVHRLVRKSPFDSGGRRHTSFSSA
Structures of the domain P07012 127-220
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5u4j X-ray 3.7 v 127-219 None


© NPIDB team 2003 - 2019

text