Pfam domain
Pfam family: HGTP_anticodon (PF03129.19)
Uniprot AC: P07236
RecName: Threonine--tRNA ligase, mitochondrial
Begin-End: 349-457
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
QAVIIPVNTKNVQQLDMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIK
SAILKNYSYLIIVGDEEVQLQKYNIRERDNRKSFEKLTMSQIWEKFIEL
Structures of the domain P07236 349-457
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yye X-ray 2.3 B 349-456 None
4yye X-ray 2.3 A 349-456 None


© NPIDB team 2003 - 2019

text