Pfam domain
Pfam family: HLH (PF00010.28)
Uniprot AC: P07270
RecName: Phosphate system positive regulatory protein PHO4
Begin-End: 251-307
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
KRESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHLQ
Structures of the domain P07270 251-307
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1a0a X-ray 2.8 B 1-57  H-Bb H-Mj L-Bb 
1a0a X-ray 2.8 A 1-57  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text